gpDB::G-protein View

CLASS	Gbeta
FAMILY	Gbeta
SUBFAMILY	Gbeta
TYPE	Gbeta-1

Cross References:
UniProt	P79959	EMBL	X86969
InterPro	IPR001632 \| IPR015943 \| IPR001680
PRODOM	PD000018
PRINTS	PR00319 \| PR00320	PFAM	PF00400

Details:
NAME	Gbeta-1-Xenopus laevis
DESCRIPTION	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1(Transducin beta chain 1) (XGbeta1).
SPECIES	Xenopus laevis	COMMON NAME	African clawed frog	NCBI Taxonomy	8355
POST TRANSLATION MODIFICATIONS	null	GENE	gnb1
SEQUENCE	MSELDQLRQEAEQLKNQIRDARKACADATLAQITANIDPVGRIQMRTRRTLRGHLAKIYA MHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNI CPIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTTTF TGHTGDVMSLSLAPDSRCFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNA FATGSDDATCRLFDLRADQELMVYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWDTL KADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN				FRAGMENT	NO
FUNCTION	Guanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems

Effectors:
1	EFF0043	Adenylate cyclase-6-Xenopus laevis	Inhibition	15251227 \| 15922020 \| 14993377 \| 11376933
2	EFF0054	Adenylate cyclase-7-Xenopus laevis	Stimulation	15251227 \| 15922020 \| 14993377 \| 11376933
3	EFF0070	ATP-sensitive inward rectifier potassium channel-1-Xenopus laevis	Stimulation	15251227 \| 10990455
4	EFF0277	Calmodulin-Xenopus laevis	Inhibition of calmodulin kinase	15251227
5	EFF0407	Kir 3.1(GIRK1)-Xenopus laevis-1	Stimulation by beta1-4-containing dimers and inhibition by beta5-containing dimers	15251227 \| 10944236 \| 12661754
6	EFF0408	Kir 3.1(GIRK1)-Xenopus laevis-2	Stimulation by beta1-4-containing dimers and inhibition by beta5-containing dimers	15251227 \| 10944236 \| 12661754
7	EFF0672	Rac-Xenopus laevis	Stimulation,Recruitment to plasma membrane	11099498 \| 15251227
8	EFF0691	Raf1 protein kinase-Xenopus laevis	Sequestration of Gβγ	15251227
9	EFF0817	Rho-Xenopus laevis-1	Recruitment to plasma membrane	15251227
10	EFF0818	Rho-Xenopus laevis-2	Recruitment to plasma membrane	15251227
11	EFF0834	SHC transforming protein-1-Xenopus laevis	Stimulation(indirect activation of MAPK)	15251227 \| 14671004 \| 7568118
12	EFF1382	Tubulin-Xenopus laevis-1	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
13	EFF1384	Tubulin-Xenopus laevis-11	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
14	EFF1385	Tubulin-Xenopus laevis-12	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
15	EFF1386	Tubulin-Xenopus laevis-13	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
16	EFF1387	Tubulin-Xenopus laevis-14	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
17	EFF1388	Tubulin-Xenopus laevis-15	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
18	EFF1389	Tubulin-Xenopus laevis-16	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
19	EFF1390	Tubulin-Xenopus laevis-17	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
20	EFF1391	Tubulin-Xenopus laevis-18	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
21	EFF1392	Tubulin-Xenopus laevis-19	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
22	EFF1393	Tubulin-Xenopus laevis-2	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
23	EFF1394	Tubulin-Xenopus laevis-20	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
24	EFF1395	Tubulin-Xenopus laevis-21	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
25	EFF1396	Tubulin-Xenopus laevis-22	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
26	EFF1397	Tubulin-Xenopus laevis-23	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
27	EFF1398	Tubulin-Xenopus laevis-24	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
28	EFF1399	Tubulin-Xenopus laevis-25	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
29	EFF1400	Tubulin-Xenopus laevis-26	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
30	EFF1401	Tubulin-Xenopus laevis-27	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
31	EFF1402	Tubulin-Xenopus laevis-28	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
32	EFF1403	Tubulin-Xenopus laevis-10	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
33	EFF1404	Tubulin-Xenopus laevis-3	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
34	EFF1405	Tubulin-Xenopus laevis-9	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
35	EFF1406	Tubulin-Xenopus laevis-4	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
36	EFF1407	Tubulin-Xenopus laevis-5	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
37	EFF1408	Tubulin-Xenopus laevis-6	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
38	EFF1409	Tubulin-Xenopus laevis-7	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
39	EFF1410	Tubulin-Xenopus laevis-8	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086

Coupling with GPCRs:
No information


Designed for viewing with Internet Explorer 4 or above, Netscape 6 or above.
contact biodbbiol.uoa.gr for comments, corrections and data (sequence) submission.

	University of Athens Faculty of Biology Dept. of Cell Biology and Biophysics	Biophysics & Bioinformatics Laboratory