gpDB::G-protein View

CLASS	Gbeta
FAMILY	Gbeta
SUBFAMILY	Gbeta
TYPE	Gbeta-1

Cross References:
UniProt	Q803H5	EMBL	BC044482 \| BC152684
InterPro	IPR001632 \| IPR015943 \| IPR001680
PRODOM	PD000018
GENEID	406796
PRINTS	PR00319 \| PR00320	PFAM	PF00400

Details:
NAME	Gbeta-1-Danio rerio
DESCRIPTION	Guanine nucleotide binding protein (G protein), beta polypeptide 1,like (Gnb1l protein).
SPECIES	Danio rerio	COMMON NAME	Zebrafish	NCBI Taxonomy	7955
POST TRANSLATION MODIFICATIONS	null	GENE	gnb1l
SEQUENCE	MSELDQLRQEAEQLKNQIRDARKACADATLSQITANIDPVGRIQMRTRRTLRGHLAKIYA MHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNI CSIYSLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTF AGHTGDVMSLSLAPDTRLFVSGACDASAKLWDIREGMCRQTFTGHESDINAICFFPNGNA FATGSDDATCRLFDLRADQELMVYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWDTL KADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN				FRAGMENT	NO
FUNCTION	-

Effectors:
1	EFF0066	ATP-sensitive inward rectifier potassium channel-1-Danio rerio	Stimulation	15251227 \| 10990455
2	EFF0159	Calmodulin-Danio rerio	Inhibition of calmodulin kinase	15251227
3	EFF0300	Dynamin-1-Brachydanio rerio	Increased GTPase activity	15251227 \| 14671004
4	EFF0358	GRK3-Danio rerio	Recruitment to plasma membrane	15251227 \| 14654303
5	EFF0540	Phospholipase C beta-3-Danio rerio	Stimulation	15251227 \| 11015615 \| 8383116
6	EFF0612	Rac-Danio rerio -1	Stimulation,Recruitment to plasma membrane	11099498 \| 15251227
7	EFF0613	Rac-Danio rerio -2	Stimulation,Recruitment to plasma membrane	11099498 \| 15251227
8	EFF0614	Rac-Danio rerio -3	Stimulation,Recruitment to plasma membrane	11099498 \| 15251227
9	EFF0615	Rac-Danio rerio -4	Stimulation,Recruitment to plasma membrane	11099498 \| 15251227
10	EFF0616	Rac-Danio rerio -5	Stimulation,Recruitment to plasma membrane	11099498 \| 15251227
11	EFF0673	Raf1 protein kinase-Danio rerio -1	Sequestration of Gβγ	15251227
12	EFF0674	Raf1 protein kinase-Danio rerio -2	Sequestration of Gβγ	15251227
13	EFF0675	Raf1 protein kinase-Danio rerio -3	Sequestration of Gβγ	15251227
14	EFF0676	Raf1 protein kinase-Danio rerio -4	Sequestration of Gβγ	15251227
15	EFF0677	Raf1 protein kinase-Danio rerio -5	Sequestration of Gβγ	15251227
16	EFF0678	Raf1 protein kinase-Danio rerio -6	Sequestration of Gβγ	15251227
17	EFF0711	Rho-Danio rerio -1	Recruitment to plasma membrane	15251227
18	EFF0712	Rho-Danio rerio -10	Recruitment to plasma membrane	15251227
19	EFF0713	Rho-Danio rerio -11	Recruitment to plasma membrane	15251227
20	EFF0714	Rho-Danio rerio -8	Recruitment to plasma membrane	15251227
21	EFF0715	Rho-Danio rerio -2	Recruitment to plasma membrane	15251227
22	EFF0716	Rho-Danio rerio -3	Recruitment to plasma membrane	15251227
23	EFF0717	Rho-Danio rerio -4	Recruitment to plasma membrane	15251227
24	EFF0718	Rho-Danio rerio -5	Recruitment to plasma membrane	15251227
25	EFF0719	Rho-Danio rerio -6	Recruitment to plasma membrane	15251227
26	EFF0720	Rho-Danio rerio -7	Recruitment to plasma membrane	15251227
27	EFF0722	Rho-Danio rerio -9	Recruitment to plasma membrane	15251227
28	EFF0882	Tsk tyrosine kinase-Danio rerio	Stimulation	15251227 \| 14671004
29	EFF0954	Tubulin-Danio rerio -1	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
30	EFF0955	Tubulin-Danio rerio -10	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
31	EFF0956	Tubulin-Danio rerio -11	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
32	EFF0957	Tubulin-Danio rerio -12	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
33	EFF0958	Tubulin-Danio rerio -13	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
34	EFF0959	Tubulin-Danio rerio -14	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
35	EFF0960	Tubulin-Danio rerio -15	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
36	EFF0961	Tubulin-Danio rerio -16	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
37	EFF0962	Tubulin-Danio rerio -17	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
38	EFF0963	Tubulin-Danio rerio -18	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
39	EFF0964	Tubulin-Danio rerio -19	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
40	EFF0965	Tubulin-Danio rerio -2	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
41	EFF0966	Tubulin-Danio rerio -20	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
42	EFF0967	Tubulin-Danio rerio -21	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
43	EFF0968	Tubulin-Danio rerio -22	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
44	EFF0969	Tubulin-Danio rerio -23	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
45	EFF0970	Tubulin-Danio rerio -24	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
46	EFF0971	Tubulin-Danio rerio -25	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
47	EFF0972	Tubulin-Danio rerio -26	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
48	EFF0973	Tubulin-Danio rerio -27	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
49	EFF0974	Tubulin-Danio rerio -28	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
50	EFF0975	Tubulin-Danio rerio -3	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
51	EFF0976	Tubulin-Danio rerio -4	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
52	EFF0977	Tubulin-Danio rerio -5	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
53	EFF0978	Tubulin-Danio rerio -6	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
54	EFF0979	Tubulin-Danio rerio -7	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
55	EFF0980	Tubulin-Danio rerio -8	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
56	EFF0981	Tubulin-Danio rerio -9	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
57	EFF1469	Voltage dependent P/Q type calcium channel-Danio rerio -1	Inhibition	15251227 \| 11031246
58	EFF1470	Voltage dependent P/Q type calcium channel-Danio rerio -2	Inhibition	15251227 \| 11031246

Coupling with GPCRs:
No information


Designed for viewing with Internet Explorer 4 or above, Netscape 6 or above.
contact biodbbiol.uoa.gr for comments, corrections and data (sequence) submission.

	University of Athens Faculty of Biology Dept. of Cell Biology and Biophysics	Biophysics & Bioinformatics Laboratory