gpDB::G-protein View

CLASS	Ggamma
FAMILY	Ggamma
SUBFAMILY	Ggamma
TYPE	Ggamma-t1

Cross References:
UniProt	P63211 \| O43835 \| Q08447 \| Q16026	EMBL	S62027 \| S62026 \| AF493869 \| CR456912 \| AC002076 \| BC029367 \| U41492
InterPro	IPR015898 \| IPR001770
PRODOM	PD003783
GENEID	2792	MIM	189970
PRINTS	PR00321	PFAM	PF00631

Details:
NAME	Ggamma-t1-Homo sapiens
DESCRIPTION	Guanine nucleotide-binding protein G(T) subunit gamma-T1 precursor(Transducin gamma chain).
SPECIES	Homo sapiens	COMMON NAME	Human	NCBI Taxonomy	9606
POST TRANSLATION MODIFICATIONS	null	GENE	GNGT1
SEQUENCE	MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPED KNPFKELKGGCVIS				FRAGMENT	NO
FUNCTION	Guanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems

Effectors:
1	EFF0002	Adenylate cyclase-1-Homo sapiens-1	Inhibition	15251227 \| 15922020 \| 14993377 \| 11376933 \| 10449730
2	EFF0003	Adenylate cyclase-1-Homo sapiens-2	Inhibition	15251227 \| 15922020 \| 14993377 \| 11376933 \| 10449730
3	EFF0006	Adenylate cyclase-2-Homo sapiens-1	Stimulation	15251227 \| 15922020 \| 14993377 \| 11376933
4	EFF0007	Adenylate cyclase-2-Homo sapiens-2	Stimulation	15251227 \| 15922020 \| 14993377 \| 11376933
5	EFF0020	Adenylate cyclase-4-Homo sapiens-1	Stimulation	15251227 \| 15922020 \| 14993377 \| 11376933
6	EFF0021	Adenylate cyclase-4-Homo sapiens-2	Stimulation	15251227 \| 15922020 \| 14993377 \| 11376933
7	EFF0030	Adenylate cyclase-5-Homo sapiens	Inhibition	15251227 \| 15922020 \| 14993377 \| 11376933
8	EFF0039	Adenylate cyclase-6-Homo sapiens	Inhibition	15251227 \| 15922020 \| 14993377 \| 11376933
9	EFF0045	Adenylate cyclase-7-Homo sapiens	Stimulation	15251227 \| 15922020 \| 14993377 \| 11376933
10	EFF0067	ATP-sensitive inward rectifier potassium channel-1-Homo sapiens	Stimulation	15251227 \| 10990455
11	EFF0071	ATP-sensitive inward rectifier potassium channel-10-Homo sapiens-1	Stimulation	15251227 \| 10990455
12	EFF0072	ATP-sensitive inward rectifier potassium channel-10-Homo sapiens-2	Stimulation	15251227 \| 10990455
13	EFF0073	ATP-sensitive inward rectifier potassium channel-10-Homo sapiens-3	Stimulation	15251227 \| 10990455
14	EFF0083	ATP-sensitive inward rectifier potassium channel-11-Homo sapiens	Stimulation	15251227 \| 10990455
15	EFF0089	ATP-sensitive inward rectifier potassium channel-12-Homo sapiens	Stimulation	15251227 \| 10990455
16	EFF0096	ATP-sensitive inward rectifier potassium channel-14-Homo sapiens	Stimulation	15251227 \| 10990455
17	EFF0101	ATP-sensitive inward rectifier potassium channel-15-Homo sapiens	Stimulation	15251227 \| 10990455
18	EFF0109	ATP-sensitive inward rectifier potassium channel-8-Homo sapiens	Stimulation	15251227 \| 10990455
19	EFF0117	Burton's tyrosine kinase-Homo sapiens-1	Stimulation	15251227 \| 11698416
20	EFF0118	Burton's tyrosine kinase-Homo sapiens-2	Stimulation	15251227 \| 11698416
21	EFF0120	Burton's tyrosine kinase-Homo sapiens-3	Stimulation	15251227 \| 11698416
22	EFF0121	Burton's tyrosine kinase-Homo sapiens-4	Stimulation	15251227 \| 11698416
23	EFF0122	Burton's tyrosine kinase-Homo sapiens-5	Stimulation	15251227 \| 11698416
24	EFF0123	Burton's tyrosine kinase-Homo sapiens-6	Stimulation	15251227 \| 11698416
25	EFF0124	Burton's tyrosine kinase-Homo sapiens-7	Stimulation	15251227 \| 11698416
26	EFF0125	Burton's tyrosine kinase-Homo sapiens-8	Stimulation	15251227 \| 11698416
27	EFF0193	Calmodulin-Homo sapiens-1	Inhibition of calmodulin kinase	15251227
28	EFF0194	Calmodulin-Homo sapiens-2	Inhibition of calmodulin kinase	15251227
29	EFF0195	Calmodulin-Homo sapiens-3	Inhibition of calmodulin kinase	15251227
30	EFF0197	Calmodulin-Homo sapiens-5	Inhibition of calmodulin kinase	15251227
31	EFF0198	Calmodulin-Homo sapiens-6	Inhibition of calmodulin kinase	15251227
32	EFF0200	Calmodulin-Homo sapiens-8	Inhibition of calmodulin kinase	15251227
33	EFF0201	Calmodulin-Homo sapiens-4	Inhibition of calmodulin kinase	15251227
34	EFF0302	Dynamin-1-Homo sapiens-1	Increased GTPase activity	15251227 \| 14671004
35	EFF0303	Dynamin-1-Homo sapiens-2	Increased GTPase activity	15251227 \| 14671004
36	EFF0304	Dynamin-1-Homo sapiens-3	Increased GTPase activity	15251227 \| 14671004
37	EFF0305	Dynamin-1-Homo sapiens-4	Increased GTPase activity	15251227 \| 14671004
38	EFF0306	Dynamin-1-Homo sapiens-5	Increased GTPase activity	15251227 \| 14671004
39	EFF0307	Dynamin-1-Homo sapiens-6	Increased GTPase activity	15251227 \| 14671004
40	EFF0308	Dynamin-1-Homo sapiens-7	Increased GTPase activity	15251227 \| 14671004
41	EFF0350	GRK2-Homo sapiens	Recruitment to plasma membrane	15251227 \| 14654303
42	EFF0359	GRK3-Homo sapiens-1	Recruitment to plasma membrane	15251227 \| 14654303
43	EFF0360	GRK3-Homo sapiens-2	Recruitment to plasma membrane	15251227 \| 14654303
44	EFF0389	Kinase suppressor of Ras(KSR)-Homo sapiens	Sequestration of Gbeta/gamma	15251227
45	EFF0397	Kir 3.1(GIRK1)-Homo sapiens-1	Stimulation by beta1-4-containing dimers and inhibition by beta5-containing dimers	15251227 \| 10944236 \| 12661754
46	EFF0398	Kir 3.1(GIRK1)-Homo sapiens-2	Stimulation by beta1-4-containing dimers and inhibition by beta5-containing dimers	15251227 \| 10944236 \| 12661754
47	EFF0410	Kir 3.2(GIRK2)-Homo sapiens	Stimulation by beta1-4-containing dimers and inhibition by beta5-containing dimers	15251227 \| 10944236 \| 12661754
48	EFF0420	Kir 3.3(GIRK3)-Homo sapiens	Stimulation by beta1-4-containing dimers and inhibition by beta5-containing dimers	14963032 \| 11779482 \| 12661754
49	EFF0425	Kir 3.4(GIRK4)-Homo sapiens-1	Stimulation by beta1-4-containing dimers and inhibition by beta5-containing dimers	15251227 \| 10944236
50	EFF0426	Kir 3.4(GIRK4)-Homo sapiens-2	Stimulation by beta1-4-containing dimers and inhibition by beta5-containing dimers	15251227 \| 10944236
51	EFF0517	Phospholipase C beta-1-Homo sapiens-1	Stimulation	15251227 \| 11015615 \| 8383116
52	EFF0521	Phospholipase C beta-1-Homo sapiens-2	Stimulation	15251227 \| 11015615 \| 8383116
53	EFF0522	Phospholipase C beta-1-Homo sapiens-3	Stimulation	15251227 \| 11015615 \| 8383116
54	EFF0530	Phospholipase C beta-2-Homo sapiens-1	Stimulation	15251227 \| 11015615 \| 8383116
55	EFF0531	Phospholipase C beta-2-Homo sapiens-2	Stimulation	15251227 \| 11015615 \| 8383116
56	EFF0541	Phospholipase C beta-3-Homo sapiens-1	Stimulation	15251227 \| 11015615 \| 8383116
57	EFF0542	Phospholipase C beta-3-Homo sapiens-2	Stimulation	15251227 \| 11015615 \| 8383116
58	EFF0572	PI3K alpha-Homo sapiens	Propable Inhibition	16182515
59	EFF0577	PI3K beta-Homo sapiens-1	Activation	9305878 \| 12502714
60	EFF0578	PI3K beta-Homo sapiens-2	Activation	9305878 \| 12502714
61	EFF0586	PI3K gamma-Homo sapiens	Activation	12502714
62	EFF0595	Protein kinase D-Homo sapiens	Stimulation	15251227
63	EFF0641	Rac-Homo sapiens-1	Stimulation,Recruitment to plasma membrane	11099498 \| 15251227
64	EFF0642	Rac-Homo sapiens-2	Stimulation,Recruitment to plasma membrane	11099498 \| 15251227
65	EFF0643	Rac-Homo sapiens-3	Stimulation,Recruitment to plasma membrane	11099498 \| 15251227
66	EFF0681	Raf1 protein kinase-Homo sapiens-1	Sequestration of Gβγ	15251227
67	EFF0682	Raf1 protein kinase-Homo sapiens-2	Sequestration of Gβγ	15251227
68	EFF0696	Ras specific nucleotide exchange factor CDC25-Homo sapiens	Stimulation (indirect activation of ras)	15251227 \| 8717044
69	EFF0736	Rho-Homo sapiens-1	Recruitment to plasma membrane	15251227
70	EFF0737	Rho-Homo sapiens-10	Recruitment to plasma membrane	15251227
71	EFF0738	Rho-Homo sapiens-11	Recruitment to plasma membrane	15251227
72	EFF0739	Rho-Homo sapiens-12	Recruitment to plasma membrane	15251227
73	EFF0740	Rho-Homo sapiens-13	Recruitment to plasma membrane	15251227
74	EFF0741	Rho-Homo sapiens-14	Recruitment to plasma membrane	15251227
75	EFF0742	Rho-Homo sapiens-15	Recruitment to plasma membrane	15251227
76	EFF0743	Rho-Homo sapiens-16	Recruitment to plasma membrane	15251227
77	EFF0745	Rho-Homo sapiens-18	Recruitment to plasma membrane	15251227
78	EFF0746	Rho-Homo sapiens-19	Recruitment to plasma membrane	15251227
79	EFF0747	Rho-Homo sapiens-2	Recruitment to plasma membrane	15251227
80	EFF0748	Rho-Homo sapiens-20	Recruitment to plasma membrane	15251227
81	EFF0749	Rho-Homo sapiens-17	Recruitment to plasma membrane	15251227
82	EFF0750	Rho-Homo sapiens-3	Recruitment to plasma membrane	15251227
83	EFF0751	Rho-Homo sapiens-4	Recruitment to plasma membrane	15251227
84	EFF0752	Rho-Homo sapiens-5	Recruitment to plasma membrane	15251227
85	EFF0753	Rho-Homo sapiens-6	Recruitment to plasma membrane	15251227
86	EFF0754	Rho-Homo sapiens-7	Recruitment to plasma membrane	15251227
87	EFF0755	Rho-Homo sapiens-8	Recruitment to plasma membrane	15251227
88	EFF0756	Rho-Homo sapiens-9	Recruitment to plasma membrane	15251227
89	EFF0819	SHC transforming protein-1-Homo sapiens-1	Stimulation(indirect activation of MAPK)	15251227 \| 14671004 \| 7568118
90	EFF0820	SHC transforming protein-1-Homo sapiens-10	Stimulation(indirect activation of MAPK)	15251227 \| 14671004 \| 7568118
91	EFF0821	SHC transforming protein-1-Homo sapiens-11	Stimulation(indirect activation of MAPK)	15251227 \| 14671004 \| 7568118
92	EFF0822	SHC transforming protein-1-Homo sapiens-2	Stimulation(indirect activation of MAPK)	15251227 \| 14671004 \| 7568118
93	EFF0823	SHC transforming protein-1-Homo sapiens-3	Stimulation(indirect activation of MAPK)	15251227 \| 14671004 \| 7568118
94	EFF0824	SHC transforming protein-1-Homo sapiens-4	Stimulation(indirect activation of MAPK)	15251227 \| 14671004 \| 7568118
95	EFF0825	SHC transforming protein-1-Homo sapiens-5	Stimulation(indirect activation of MAPK)	15251227 \| 14671004 \| 7568118
96	EFF0826	SHC transforming protein-1-Homo sapiens-6	Stimulation(indirect activation of MAPK)	15251227 \| 14671004 \| 7568118
97	EFF0827	SHC transforming protein-1-Homo sapiens-7	Stimulation(indirect activation of MAPK)	15251227 \| 14671004 \| 7568118
98	EFF0828	SHC transforming protein-1-Homo sapiens-8	Stimulation(indirect activation of MAPK)	15251227 \| 14671004 \| 7568118
99	EFF0829	SHC transforming protein-1-Homo sapiens-9	Stimulation(indirect activation of MAPK)	15251227 \| 14671004 \| 7568118
100	EFF0835	SHC transforming protein-2-Homo sapiens	Stimulation(indirect activation of MAPK)	15251227 \| 14671004 \| 7568118
101	EFF0838	SHC transforming protein-3-Homo sapiens-1	Stimulation(indirect activation of MAPK)	15251227 \| 14671004 \| 7568118
102	EFF0839	SHC transforming protein-3-Homo sapiens-2	Stimulation(indirect activation of MAPK)	15251227 \| 14671004 \| 7568118
103	EFF0840	SHC transforming protein-3-Homo sapiens-3	Stimulation(indirect activation of MAPK)	15251227 \| 14671004 \| 7568118
104	EFF0884	Tsk tyrosine kinase-Homo sapiens	Stimulation	15251227 \| 14671004
105	EFF1126	Tubulin-Homo sapiens-1	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
106	EFF1127	Tubulin-Homo sapiens-10	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
107	EFF1128	Tubulin-Homo sapiens-11	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
108	EFF1129	Tubulin-Homo sapiens-12	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
109	EFF1130	Tubulin-Homo sapiens-13	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
110	EFF1131	Tubulin-Homo sapiens-14	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
111	EFF1132	Tubulin-Homo sapiens-15	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
112	EFF1133	Tubulin-Homo sapiens-16	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
113	EFF1134	Tubulin-Homo sapiens-17	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
114	EFF1135	Tubulin-Homo sapiens-18	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
115	EFF1136	Tubulin-Homo sapiens-19	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
116	EFF1137	Tubulin-Homo sapiens-2	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
117	EFF1138	Tubulin-Homo sapiens-20	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
118	EFF1139	Tubulin-Homo sapiens-21	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
119	EFF1140	Tubulin-Homo sapiens-22	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
120	EFF1141	Tubulin-Homo sapiens-23	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
121	EFF1143	Tubulin-Homo sapiens-25	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
122	EFF1144	Tubulin-Homo sapiens-26	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
123	EFF1145	Tubulin-Homo sapiens-27	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
124	EFF1146	Tubulin-Homo sapiens-28	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
125	EFF1148	Tubulin-Homo sapiens-3	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
126	EFF1149	Tubulin-Homo sapiens-30	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
127	EFF1150	Tubulin-Homo sapiens-31	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
128	EFF1151	Tubulin-Homo sapiens-32	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
129	EFF1152	Tubulin-Homo sapiens-33	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
130	EFF1153	Tubulin-Homo sapiens-34	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
131	EFF1154	Tubulin-Homo sapiens-35	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
132	EFF1156	Tubulin-Homo sapiens-37	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
133	EFF1157	Tubulin-Homo sapiens-38	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
134	EFF1158	Tubulin-Homo sapiens-39	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
135	EFF1159	Tubulin-Homo sapiens-4	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
136	EFF1160	Tubulin-Homo sapiens-40	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
137	EFF1162	Tubulin-Homo sapiens-42	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
138	EFF1163	Tubulin-Homo sapiens-43	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
139	EFF1164	Tubulin-Homo sapiens-44	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
140	EFF1165	Tubulin-Homo sapiens-45	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
141	EFF1166	Tubulin-Homo sapiens-46	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
142	EFF1167	Tubulin-Homo sapiens-47	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
143	EFF1168	Tubulin-Homo sapiens-48	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
144	EFF1169	Tubulin-Homo sapiens-49	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
145	EFF1170	Tubulin-Homo sapiens-5	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
146	EFF1171	Tubulin-Homo sapiens-50	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
147	EFF1173	Tubulin-Homo sapiens-52	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
148	EFF1174	Tubulin-Homo sapiens-51	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
149	EFF1175	Tubulin-Homo sapiens-41	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
150	EFF1176	Tubulin-Homo sapiens-36	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
151	EFF1177	Tubulin-Homo sapiens-29	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
152	EFF1178	Tubulin-Homo sapiens-24	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
153	EFF1179	Tubulin-Homo sapiens-6	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
154	EFF1180	Tubulin-Homo sapiens-7	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
155	EFF1181	Tubulin-Homo sapiens-8	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
156	EFF1182	Tubulin-Homo sapiens-9	Increased GTPase activity	15251227 \| 14671004 \| 12807915 \| 17705289 \| 16380086
157	EFF1443	Voltage dependent N type calcium channel-Homo sapiens-1	Inhibition	15251227 \| 11031246
158	EFF1444	Voltage dependent N type calcium channel-Homo sapiens-10	Inhibition	15251227 \| 11031246
159	EFF1445	Voltage dependent N type calcium channel-Homo sapiens-11	Inhibition	15251227 \| 11031246
160	EFF1446	Voltage dependent N type calcium channel-Homo sapiens-12	Inhibition	15251227 \| 11031246
161	EFF1447	Voltage dependent N type calcium channel-Homo sapiens-13	Inhibition	15251227 \| 11031246
162	EFF1448	Voltage dependent N type calcium channel-Homo sapiens-14	Inhibition	15251227 \| 11031246
163	EFF1449	Voltage dependent N type calcium channel-Homo sapiens-7	Inhibition	15251227 \| 11031246
164	EFF1450	Voltage dependent N type calcium channel-Homo sapiens-6	Inhibition	15251227 \| 11031246
165	EFF1451	Voltage dependent N type calcium channel-Homo sapiens-5	Inhibition	15251227 \| 11031246
166	EFF1452	Voltage dependent N type calcium channel-Homo sapiens-4	Inhibition	15251227 \| 11031246
167	EFF1453	Voltage dependent N type calcium channel-Homo sapiens-2	Inhibition	15251227 \| 11031246
168	EFF1454	Voltage dependent N type calcium channel-Homo sapiens-3	Inhibition	15251227 \| 11031246
169	EFF1459	Voltage dependent N type calcium channel-Homo sapiens-8	Inhibition	15251227 \| 11031246
170	EFF1460	Voltage dependent N type calcium channel-Homo sapiens-9	Inhibition	15251227 \| 11031246
171	EFF1472	Voltage dependent P/Q type calcium channel-Homo sapiens-1	Inhibition	15251227 \| 11031246
172	EFF1473	Voltage dependent P/Q type calcium channel-Homo sapiens-2	Inhibition	15251227 \| 11031246
173	EFF1474	Voltage dependent P/Q type calcium channel-Homo sapiens-3	Inhibition	15251227 \| 11031246
174	EFF1475	Voltage dependent P/Q type calcium channel-Homo sapiens-4	Inhibition	15251227 \| 11031246
175	EFF1476	Voltage dependent P/Q type calcium channel-Homo sapiens-5	Inhibition	15251227 \| 11031246
176	EFF1477	Voltage dependent P/Q type calcium channel-Homo sapiens-6	Inhibition	15251227 \| 11031246
177	EFF1498	Voltage dependent R type calcium channel-Homo sapiens-1	Inhibition	15251227 \| 11031246
178	EFF1499	Voltage dependent R type calcium channel-Homo sapiens-2	Inhibition	15251227 \| 11031246
179	EFF1503	Voltage dependent R type calcium channel-Homo sapiens-5	Inhibition	15251227 \| 11031246
180	EFF1504	Voltage dependent R type calcium channel-Homo sapiens-4	Inhibition	15251227 \| 11031246
181	EFF1505	Voltage dependent R type calcium channel-Homo sapiens-3	Inhibition	15251227 \| 11031246

Coupling with GPCRs:
No information


Designed for viewing with Internet Explorer 4 or above, Netscape 6 or above.
contact biodbbiol.uoa.gr for comments, corrections and data (sequence) submission.

	University of Athens Faculty of Biology Dept. of Cell Biology and Biophysics	Biophysics & Bioinformatics Laboratory